Recombinant Full Length Rhodopirellula Baltica Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL8588RF |
Product Overview : | Recombinant Full Length Rhodopirellula baltica Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q7ULB5) (1-684aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopirellula baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-684) |
Form : | Lyophilized powder |
AA Sequence : | MIQLYGLRKDYRVGDHDLPVLKGITLNIEAGEYVALMGSSGSGKTTLMNLLGSLDHPTDG DYHLAGIDVSSLTPLELAAFRSQHIGFVFQNFNLLPRATALDNVMLPTIYASDGRSRREC IEDATKLLESVGLGGRLDHMPNQLSGGERQRIAIARALMNRPKLLLADEPTGNLDTVTEQ EILALFRQLNQEHGITLVVVTHDAEVAHEADRVVRMKDGLVAEDVRQRASTVDRSRLANS RAEPLREPASAWSLPATWNAIVVAVLALRRNALRTVLTMLGVIIGVASVISTMELSAGAS TAIEETVASMGASMLTISPGKASSTSGRQRPIQIIPDDVVAVAEQCSAVKVAAPLVYSQV QLVRQNRRWSPNLALGTTSQYLAARNWDQLELGTPFTQEQVLDAAKVCILGKTVAHELFD SEYPIGEEIRVNGVPLRVVGVLTEKGGDVIGNDQDDIIIGPWTTFKLRVNSSTGATAQFS TFADQMPPMQLASTRRSTQREEIHQIYVEAESPDHVELARQQITQVLSRRHNVEPAGAYR INDITEVSKVVGQVVGGVSALGLVIAGVSLMVGGVGIMNIMLVSVTERTREIGLRMAVGA NRSAILRQFLIEATVLCVVGGFIGIFAGHMWSVLVGRVIGWPTAMSIWAPIVAVTVAATV GIVFGYYPARTASRLNPIDALRYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; RB9611; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q7ULB5 |
◆ Recombinant Proteins | ||
HOXA13-5715C | Recombinant Chicken HOXA13 | +Inquiry |
vpl1-6421P | Recombinant Pleurotus eryngii vpl1 protein(31-361aa), His&Myc-tagged | +Inquiry |
PTH2R-8954Z | Recombinant Zebrafish PTH2R | +Inquiry |
REEP1-5097H | Recombinant Human REEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Il5-01M | Active Recombinant Mouse Il5 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM38B-6381HCL | Recombinant Human FAM38B 293 Cell Lysate | +Inquiry |
ANAPC13-8867HCL | Recombinant Human ANAPC13 293 Cell Lysate | +Inquiry |
Cerebral Meninges-75R | Rhesus monkey Cerebral Meninges Lysate | +Inquiry |
PAPOLB-470HCL | Recombinant Human PAPOLB lysate | +Inquiry |
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket