Recombinant Full Length Salmonella Choleraesuis Cellulose Synthesis Regulatory Protein(Yedq) Protein, His-Tagged
Cat.No. : | RFL8308SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Cellulose synthesis regulatory protein(yedQ) Protein (Q57N14) (1-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-570) |
Form : | Lyophilized powder |
AA Sequence : | MPHETLLDNQGWFKKLARRFGPGHVVNTCFLIVMLFSTLLTWREVMILKDAYVASQRNHL GSVANVLDRQLQFNMDRLIFLRNGMHEALVAPLAFSALQSAVTQFEQRRVRHFWQLELDK RRTLPLYGVSDQFVARTTLLSRESRDLANELTATLELGYLARLARSSAMLTLETMYVSCS GFYLSTLPTAYGSDIVSRYYQYVTQPWFIEQSQRRNPQRGVRWFTSAQPYVADEQKKVTA SLPLDHDNYWYGVLAMDIPVASLQRFLRDAAEKDIEGEYQLYDNHLRLLTDSAPEQQTAN TLNDRERALLAREIEKDTLGGLRLGTHYVSWERLDHFDGVLLRVHTLREGIQGNFGSISI ALTLLWVLFTAMLLISWGVIRHMVKNMFVLQNSLQWQAWHDPLTRLYNRGALFEKASRLA KRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGGEE FCIVLPGATKAQALQIAERIRQRINDKEILVTKSTTLRISASMGISSAEEYGDYDFEQLQ SLADKRLYYAKQSGRNRICASDATQEREKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcQ |
Synonyms | dgcQ; yedQ; SCH_1991; Probable diguanylate cyclase DgcQ; DGC; Cellulose synthesis regulatory protein |
UniProt ID | Q57N14 |
◆ Recombinant Proteins | ||
RFL7962RF | Recombinant Full Length Rat Phosphatidylcholine:Ceramide Cholinephosphotransferase 1(Sgms1) Protein, His-Tagged | +Inquiry |
SEPT11-4982R | Recombinant Rat SEPT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lypla1-7304M | Recombinant Mouse Lypla1 Protein, His-tagged | +Inquiry |
ATP2B1-861R | Recombinant Rat ATP2B1 Protein | +Inquiry |
IL31-172M | Recombinant Mouse IL31 Protein | +Inquiry |
◆ Native Proteins | ||
C3-012H | Native Human Complement C3c | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
IgE-01M | Native Mouse IgE protein | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD5-81HCL | Recombinant Human ANKRD5 cell lysate | +Inquiry |
KDM4D-4993HCL | Recombinant Human KDM4D 293 Cell Lysate | +Inquiry |
MTMR2-4075HCL | Recombinant Human MTMR2 293 Cell Lysate | +Inquiry |
KIR2DL1-1701HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
CAPN7-7860HCL | Recombinant Human CAPN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcQ Products
Required fields are marked with *
My Review for All dgcQ Products
Required fields are marked with *
0
Inquiry Basket