Recombinant Escherichia coli DGCQ Protein (381-564 aa), GST-tagged

• Cat.No.: DGCQ-1221E
• Product Overview: Recombinant Escherichia coli (strain K12) DGCQ Protein (381-564 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: E.coli
• Source: E.coli
• Tag: GST
• ProteinLength: 381-564 aa
• Description: Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 47.5 kDa
• AA Sequence: RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: dgcQ putative diguanylate cyclase DgcQ [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: DGCQ
• Synonyms: ECK1954; yedQ
• Gene ID: 946471
• Protein Refseq: NP_416465
• UniProt ID: P76330