Recombinant Full Length Putative Cellulose Synthesis Regulatory Protein(Yedq) Protein, His-Tagged
Cat.No. : | RFL18604SF |
Product Overview : | Recombinant Full Length Putative cellulose synthesis regulatory protein(yedQ) Protein (Q83KM9) (1-569aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-569) |
Form : | Lyophilized powder |
AA Sequence : | MGVVRVQHETKMENQSWLKKLARRLGPGHVVNLCFIVVLLFSTLLTWREVVVLEDAYISS QRNHLENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRNAVTEFEQHRDEHAWQ IELNRRRTLPVNGVSDALVSEGNFLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAM YVSRAGFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTE PQVTVSVPVDSNNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPD HPTGNIFDPRELALLAQAMEHDTRGGIRMDSRYVSWERLDHFDGVLARVHTLSEGVRGDF GSISIALTLLWALFTTMLLLSWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEK ARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGR VGGEEFCVILPGANLTQAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYD FEQLQSLADRRLYLAKQAGRNRVFASDNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcQ |
Synonyms | dgcQ; yedQ; SF2000; S2095; Putative diguanylate cyclase DgcQ; DGC; Cellulose synthesis regulatory protein |
UniProt ID | Q83KM9 |
◆ Native Proteins | ||
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf53-8344HCL | Recombinant Human C11orf53 293 Cell Lysate | +Inquiry |
TMED1-1340HCL | Recombinant Human TMED1 cell lysate | +Inquiry |
TCEAL6-1750HCL | Recombinant Human TCEAL6 cell lysate | +Inquiry |
PRRT2-1420HCL | Recombinant Human PRRT2 cell lysate | +Inquiry |
Precentral Gyrus-400C | Cynomolgus monkey Precentral Gyrus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dgcQ Products
Required fields are marked with *
My Review for All dgcQ Products
Required fields are marked with *
0
Inquiry Basket