Recombinant Full Length Cellulose Synthesis Regulatory Protein(Yedq) Protein, His-Tagged
Cat.No. : | RFL14466SF |
Product Overview : | Recombinant Full Length Cellulose synthesis regulatory protein(yedQ) Protein (Q8Z5R0) (1-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-567) |
Form : | Lyophilized powder |
AA Sequence : | MPHETLLDNQGWFKKLARRFGPGHVVNTCFLIVMLFSTLLTWREVMILKDAYVASQRNHL GSVANVLDRQLQFNMDRLIFLRNGMHEALVAPLAFSALQSAVTQFEQRRVRHFWQLELDK RRTLPLYGVSDQFVARTTLLSRESRDLANELTATLELGYLARSSAMLTLETMYVSRSGFY LSTLPTAYGSDIVSRYYQYVTQPWFIEQSQRRNPQRGVRWFTSAQPYVADEQKKVTASLP LDHDNYWYGVLAMDIPVASLQQFLRDAAEKDIEGEYQLYDNHLRLLTDSAPEQQTENTLN DRERALLAREIEKDTLGGLRLGTHYVSWERLDHFDGVLLRVHTLREGIQGNFGSISIALT LLWGLFTAMLLISWGVIRHMVKNMFVLQNSPQWQAWHDPLTRLYNRGALFEKASRLAKRY REARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGGEEFCI VLPGATKAQALQIAERIRQRINDKEILVTKSTTLRISASMGISSAEEYGDYDFEQLQSLA DKRLYYAKQSGRNRICASDATQEREKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcQ |
Synonyms | dgcQ; yedQ; STY2194; t0891; Probable diguanylate cyclase DgcQ; DGC; Cellulose synthesis regulatory protein |
UniProt ID | Q8Z5R0 |
◆ Recombinant Proteins | ||
RFL19216RF | Recombinant Full Length Rat Atp-Binding Cassette Sub-Family G Member 5(Abcg5) Protein, His-Tagged | +Inquiry |
CCDC146-1175R | Recombinant Rat CCDC146 Protein | +Inquiry |
ZBED3-5064R | Recombinant Rhesus Macaque ZBED3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD7-2337M | Recombinant Mouse CD7 protein(Met1-Pro150), hFc-tagged | +Inquiry |
VTA1-4993R | Recombinant Rhesus Macaque VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF8-7054HCL | Recombinant Human DCAF8 293 Cell Lysate | +Inquiry |
ATP5A1-8606HCL | Recombinant Human ATP5A1 293 Cell Lysate | +Inquiry |
Liver-289C | Cynomolgus monkey Liver Lysate | +Inquiry |
ZNF280C-1721HCL | Recombinant Human ZNF280C cell lysate | +Inquiry |
CDKL1-7619HCL | Recombinant Human CDKL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcQ Products
Required fields are marked with *
My Review for All dgcQ Products
Required fields are marked with *
0
Inquiry Basket