Recombinant Full Length Cellulose Synthesis Regulatory Protein(Yedq) Protein, His-Tagged
Cat.No. : | RFL29584EF |
Product Overview : | Recombinant Full Length Cellulose synthesis regulatory protein(yedQ) Protein (Q8FGJ7) (1-569aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-569) |
Form : | Lyophilized powder |
AA Sequence : | MGVVRVQHETKMENQSWLKKLARRLGPGHIVNLCFIVVLLFSTLLTWREVVVLEDAYISS QRNHLENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRNAVTEFEQHRDEHAWQ IELNRRRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAV YVSRAGFYVSTLPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTE PQVTVSVPVDSNNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPD HPTGNIFDPRELALLAQAMEHDTRGGIRMDSRYVSWERLDHFDGVLVRVHTLSEGVRGDF GSISIALTLLWALFTSMLLLSWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEK ACPLAKLCHTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDIAGR VGGEEFCVILPGANLTQAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYD FEQLQSLADRRLYLAKQAGRNRVFASDNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcQ |
Synonyms | dgcQ; yedQ; c2374; Probable diguanylate cyclase DgcQ; DGC; Cellulose synthesis regulatory protein |
UniProt ID | Q8FGJ7 |
◆ Recombinant Proteins | ||
B3GNT2-2526H | Recombinant Human B3GNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRUNE-13535M | Recombinant Mouse PRUNE Protein | +Inquiry |
BSG-10H | Active Recombinant Human BSG Protein, Fc/His-tagged, Alexa Fluor® 647 conjugated | +Inquiry |
MAP4K5-3965H | Recombinant Human MAP4K5 Protein (Thr613-His842), N-His tagged | +Inquiry |
EIF3E-1493C | Recombinant Chicken EIF3E | +Inquiry |
◆ Native Proteins | ||
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
CFI-105H | Active Native Human Factor I | +Inquiry |
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELP-972MCL | Recombinant Mouse SELP cell lysate | +Inquiry |
ADD1-9017HCL | Recombinant Human ADD1 293 Cell Lysate | +Inquiry |
CNPY4-1284HCL | Recombinant Human CNPY4 cell lysate | +Inquiry |
KCNK6-5032HCL | Recombinant Human KCNK6 293 Cell Lysate | +Inquiry |
ENPEP-001RCL | Recombinant Rat ENPEP cell lysate, His Tag | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcQ Products
Required fields are marked with *
My Review for All dgcQ Products
Required fields are marked with *
0
Inquiry Basket