Recombinant Full Length Saccharomyces Cerevisiae Protein Cos1(Cos1) Protein, His-Tagged
Cat.No. : | RFL22505SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein COS1(COS1) Protein (P53822) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPH DWEVVAANLNSYLYENKAWNTKYFFFNAMVCQEAFRTTLLEPFSLKKDEAAKVKSFKDSV PYIEEALGVYFREVEKQWKLFNSEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI PFLNFLCCIYVSRGMCLLLRTFYLGWILFMLVQGFQNMRMIVLSVKMEHKMQFLSTIINE QESGANGWDEIAKKMNRYLFEKKVWKNEEFFFDGIDCEWFFSHFFYRVLSAKKSMRALSL NVELWPYIKEAQLSCSEESLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COS1 |
Synonyms | COS1; YNL336W; N0275; Protein COS1 |
UniProt ID | P53822 |
◆ Recombinant Proteins | ||
PAK4-3316H | Recombinant Human PAK4 protein, His-SUMO-tagged | +Inquiry |
SIPRA-133B | Recombinant Bovine SIRPA Protein, Fc-tagged | +Inquiry |
IARS2-14027H | Recombinant Human IARS2 protein, His-tagged | +Inquiry |
S-16S | Recombinant SARS-CoV-2 S Protein, mFc-tagged | +Inquiry |
OLIG2-3842H | Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PTI-603B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IQCE-5178HCL | Recombinant Human IQCE 293 Cell Lysate | +Inquiry |
COPB2-7362HCL | Recombinant Human COPB2 293 Cell Lysate | +Inquiry |
GRK7-753HCL | Recombinant Human GRK7 cell lysate | +Inquiry |
C10orf137-195HCL | Recombinant Human C10orf137 cell lysate | +Inquiry |
NFE2-3855HCL | Recombinant Human NFE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COS1 Products
Required fields are marked with *
My Review for All COS1 Products
Required fields are marked with *
0
Inquiry Basket