Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OLIG2-3842H
• Product Overview: OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
• Molecular Mass: 32.2 kDa
• AA Sequence: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens (human) ]
• Official Symbol: OLIG2
• Synonyms: OLIG2; oligodendrocyte lineage transcription factor 2; oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B, 1; oligodendrocyte-specific bHLH transcription factor 2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19
• Gene ID: 10215
• mRNA Refseq: NM_005806
• Protein Refseq: NP_005797
• MIM: 606386
• UniProt ID: Q13516