Recombinant Full Length Saccharomyces Bayanus Sterol O-Acyltransferase 1(Are1) Protein, His-Tagged
Cat.No. : | RFL19579SF |
Product Overview : | Recombinant Full Length Saccharomyces bayanus Sterol O-acyltransferase 1(ARE1) Protein (Q876L3) (1-623aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saccharomyces uvarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-623) |
Form : | Lyophilized powder |
AA Sequence : | MTEAKELLQDERFLKIQELNSAEPSKRHSVTYDNVILPQESVEVSPRSSTTSLEEPATTT ATGVAVAAAAAAAEKKKKKKGEDGDDEQDEQAEEKYPVDPRMQKYLSHLKSKSRTRVHRK DASKYVSFFGDVSFDPRPTLLDSAVNVPFQTTFKGPVLEKQLKGLQQTKKGEVAAAAATA ATAATAAAAPPGKKLESNFSGIYVFAWMFMGWIAFRSCMDYYVSHEGGFASMEIVQYMTS DLFTIALLDLALFLSTFFVVFVHWLVKLGFIRWKWTGFVAVSLFELCFIPVSFPVYVYYF HFSWVTRIFLFLHSVVLLMKAHSFAFYNGYLWDIKNELEFSSNKLNKFKESLSPETKDIL QKSCDFCLFELNYQTKDNDFPNNISCSNYFMFCMFPVLVYQINYPRTSHIRWRYVLEKFC AIMGTIFLMMVTAQIFMHPVAMRCIEYHDTPSFGGWVPAVKQWLFLLFEMIPGFSVLYML TFYMIWDALLNCVAELTRFADRYFYGDWWNCVSFEEFSRIWNVPVHKFLLRHVYHSSMGA LHFSKAQATLFTFLLSAVFHEIAMFAIFKEVRGYLFLFQLSQFAWTALSNTKFLRSRPQL SNVVFTFGVCTGPSMIMTLYLTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARE1 |
Synonyms | ARE1; Sterol O-acyltransferase 1; Sterol-ester synthase 1 |
UniProt ID | Q876L3 |
◆ Recombinant Proteins | ||
Gad1-8148M | Recombinant Mouse Gad1 protein, His & S-tagged | +Inquiry |
RBM4-31230TH | Recombinant Full Length Human RBM4, His-tagged | +Inquiry |
SOWAHC-15769M | Recombinant Mouse SOWAHC Protein | +Inquiry |
LSM5-2585R | Recombinant Rhesus monkey LSM5 Protein, His-tagged | +Inquiry |
ACOT9-2049C | Recombinant Chicken ACOT9 | +Inquiry |
◆ Native Proteins | ||
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNK1-886HCL | Recombinant Human TNK1 293 Cell Lysate | +Inquiry |
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
TMED8-1022HCL | Recombinant Human TMED8 293 Cell Lysate | +Inquiry |
C9orf100-7944HCL | Recombinant Human C9orf100 293 Cell Lysate | +Inquiry |
GTF2IRD1-5692HCL | Recombinant Human GTF2IRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ARE1 Products
Required fields are marked with *
My Review for All ARE1 Products
Required fields are marked with *
0
Inquiry Basket