Recombinant Full Length Human RBM4, His-tagged

Cat.No. : RBM4-31230TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-364 of Human RBM4 with N terminal His tag, 45kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-364 a.a.
Description : This gene encodes a protein that contains 2 RRM type RNA binding motifs and a retroviral type zinc finger.RBM4 may play a role in alternative splice site selection during pre mRNA processing.It binds TNPO3, which mediates nuclear import of the protein. This interaction is disrupted by nuclear Ran bound to GTP. RBM4 is ubiquitously expressed. It is expressed in fetal brain and is down regulated in fetal Down syndrome brain.
Form : Lyophilised. 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5.
AA Sequence : MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVE ASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIR GLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQY NEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQ LPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAA AAA VTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAA RNSLYDMARYEREQ YADRARYSAF
Applications : SDS-PAGE; Mass Spectrometry
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Reconstitution : Reconstitute with 84 µl aqua dest.
Full Length : Full L.
Gene Name RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ]
Official Symbol RBM4
Synonyms RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A
Gene ID 5936
mRNA Refseq NM_001198843
Protein Refseq NP_001185772
MIM 602571
UniProt ID Q9BWF3
Chromosome Location 11q13
Function RNA binding; mRNA 3'-UTR binding; nucleotide binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBM4 Products

Required fields are marked with *

My Review for All RBM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon