Recombinant Full Length Rutilus Rutilus Melanopsin(Opn4) Protein, His-Tagged
Cat.No. : | RFL13891RF |
Product Overview : | Recombinant Full Length Rutilus rutilus Melanopsin(opn4) Protein (Q6XL69) (1-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rutilus rutilus (Roach) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-500) |
Form : | Lyophilized powder |
AA Sequence : | MSHHSSWRGHHCAPGDNNCTAGFKESLGSKNYKLLHVPFHGPTHSHHHEPPHPFPTVDVP DHAHYIIGAVILIVGITGVIGNALVIYVFCRSRTLRTAGNMFVVNLAVADFFMSLTQSPV FFAASLHRRWIFGERICELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVGNVSRRK AGAVLAVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFIFVFFI PLGIIVSCYVGIFQAIRAMGKEIRELDCGETQKVYERMQNEWKMAKIALLVILLFVISWS PYSVVALTATAGYSHLLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRAAIARYIPVLRT ILRVKEKELRSSFSSGSVSSRRPTLSSQCSLGVSIGNAARANGRWGKKRLSSASDSDSCW TESEADGSSVSSLTFGRRVSTEISTDTVILSPGSSNSTASGQKSEKAHKVVSVPVPSITF ETDSADESLSDGKALLLGGN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opn4 |
Synonyms | opn4; Melanopsin; Opsin-4 |
UniProt ID | Q6XL69 |
◆ Native Proteins | ||
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
HP-199M | Native Monkey Haptoglobin | +Inquiry |
PLAT-30920TH | Native Human PLAT | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-16H | Human Colon Tissue Lysate | +Inquiry |
CDK2AP1-7628HCL | Recombinant Human CDK2AP1 293 Cell Lysate | +Inquiry |
CLEC4A3-1111RCL | Recombinant Rat CLEC4A3 cell lysate | +Inquiry |
EFNB2-936HCL | Recombinant Human EFNB2 cell lysate | +Inquiry |
AIMP2-8951HCL | Recombinant Human AIMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opn4 Products
Required fields are marked with *
My Review for All opn4 Products
Required fields are marked with *
0
Inquiry Basket