Recombinant Full Length Phodopus Sungorus Melanopsin(Opn4) Protein, His-Tagged
Cat.No. : | RFL2917PF |
Product Overview : | Recombinant Full Length Phodopus sungorus Melanopsin(OPN4) Protein (Q5XXP2) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MDSPPGPTAPPGLTQGPSFMASTTLHSHWNSTQKVSTRAQLLAVSPTASGPEAAAWVPFP TVDVPDHAHYILGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMLIINLAVSDFLMSF TQAPVFFASSLYKKWLFGETGCEFYAFCGAVLGITSMITLTAIALDRYLVITRPLATIGM GSKRRTALVLLGIWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPQVRAYTMLLFC FVFFLPLLVIIFCYISIFRAIRETGRACEGWSESPQRRRQWHRLQSEWKMAKVALIVILL FVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIVYAITHPKYRAAIAQH LPCLGVLLGVSSQRNRPSLSYRSTHRSTLSSQSSDLSWISAPKRQESLGSESEVGWTDTE ATAVWGAAQPASGQSSCGQNLEDGMVKAPSSPQAKGQLPSLDLGMQDAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPN4 |
Synonyms | OPN4; Melanopsin; Opsin-4 |
UniProt ID | Q5XXP2 |
◆ Recombinant Proteins | ||
RFL26701FF | Recombinant Full Length Cat Melanopsin(Opn4) Protein, His-Tagged | +Inquiry |
OPN4-3445C | Recombinant Chicken OPN4 | +Inquiry |
OPN4-3732H | Recombinant Human OPN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Opn4-10254R | Recombinant Rat Opn4 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL13891RF | Recombinant Full Length Rutilus Rutilus Melanopsin(Opn4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OPN4-3574HCL | Recombinant Human OPN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPN4 Products
Required fields are marked with *
My Review for All OPN4 Products
Required fields are marked with *
0
Inquiry Basket