Recombinant Full Length Rickettsia Conorii Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL11649RF |
Product Overview : | Recombinant Full Length Rickettsia conorii Apolipoprotein N-acyltransferase(lnt) Protein (Q92IC5) (1-499aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia conorii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-499) |
Form : | Lyophilized powder |
AA Sequence : | MYKPKIICLLLGILSGLVFAPTFFIPALLTLSYLCYIVQKSENWQEATKFGYLFGFGHFL SGIYWISIGVSVYIADFWWAIPFALFGLPIVLACFISASCTLSFFAKNNKYYQFIFCLCW VLFEWVRSWIFTGLPWNLIGYAFSFSDILIQPLSIIGIYGLSFIVIYISTSAYPLFSKQF TQLKILLASSVLVLTIIVIYGAVRLSNNHTNFTDIKVRLVQPSIPQTEKWNEEEFWHNLM LHINLSENLEPTDLIIWSEAALVVPDDIPQVKSKLLKMLNSTNAILITGGISDNKKQGDE FELYSAMYALDKNNHKLFEYHKSHLVPFGEYMPLKKILPFKKLTHGLIDYKEGNGGLVYL EKYNLKIKPLICYESIFPDFVRTNNEIADVIINITNDAWYGKSSGPYQHFHISRSRAVEN GLPMIRVANNGISAIVDPFGRTIKKLNLNEINGTQGLIPKKLISPTIFSQFGNFTILLLI VFILLINYLLALILDHQRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RC0495; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q92IC5 |
◆ Recombinant Proteins | ||
PVRIG-230C | Active Recombinant Cynomolgus PVRIG protein, Fc-tagged | +Inquiry |
RPS27L-14486M | Recombinant Mouse RPS27L Protein | +Inquiry |
ASB3-1272HF | Recombinant Full Length Human ASB3 Protein, GST-tagged | +Inquiry |
CD28-640MAF647 | Recombinant Mouse CD28 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TFF3-6030R | Recombinant Rat Tff3 protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-5276H | Native Human, Catalase | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA4-4553HCL | Recombinant Human MAGEA4 293 Cell Lysate | +Inquiry |
MAPK10-4499HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
KRBA2-997HCL | Recombinant Human KRBA2 cell lysate | +Inquiry |
LRRFIP1-4620HCL | Recombinant Human LRRFIP1 293 Cell Lysate | +Inquiry |
IL1R1-1787MCL | Recombinant Mouse IL1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket