Recombinant Full Length Vibrio Vulnificus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL1940VF |
Product Overview : | Recombinant Full Length Vibrio vulnificus Apolipoprotein N-acyltransferase(lnt) Protein (Q7MN04) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MKNTLFHRLKRPIAAAFVGALTTLAFAPYQIWLVALITPALLLILIHGQSRRQAIWTGYA WGLGQFASGISWVYVSIAGFGGMPLAANLFLMGALIAYLAIYPALFTWSYQRFFAKATLL NLLLAAPALWLIADWLRGWVMTGFPWLWLGYSQIDSPLASFAPIGGVELLTLLLLVGAGA IAYAVIHKRWSMLLIPTVLLSTGYGLSHWDWVTPQPDKTTKVALIQGNVDQNLKWLPSQR WPTIMKYTDLSRENWDADIIIWPEAAIPAFEVELPSYLSNLDSAAKMNQSAIISGIVNQA EDGQFYNSILAVGLTPYGDYSFDLTERYHKHHLLPFGEFVPFESILRPLAPFFNLPMSSF SRGDFVQPNIVANGHPMAPALCYEIIFNEQVRQNVTDDTDFLLTLSNDAWFGRSIGPLQH MEIARMRALELGKPLIRSTNNGLTAVTDHRGKIIASIPQFETAVLRAELTPTQGQTPYHQ LGSWPLYIWVALSLALAWWRKRRTNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; VV0913; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7MN04 |
◆ Recombinant Proteins | ||
SLC5A1-480HF | Recombinant Full Length Human SLC5A1 Protein, GST-tagged | +Inquiry |
HBG1-4600H | Recombinant Human HBG1 Protein, GST-tagged | +Inquiry |
CssIV-4070M | Recombinant Mexican scorpion CssIV protein, His-SUMO-tagged | +Inquiry |
ARSG-384H | Recombinant Human ARSG Protein, His (Fc)-Avi-tagged | +Inquiry |
HA-626V | Active Recombinant H7N9 (A/Hangzhou/1/2013) HA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ITGA9-5130HCL | Recombinant Human ITGA9 293 Cell Lysate | +Inquiry |
GPNMB-1886HCL | Recombinant Human GPNMB cell lysate | +Inquiry |
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
Spleen-474R | Rhesus monkey Spleen Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket