Recombinant Full Length Haemophilus Influenzae Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL27975HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Apolipoprotein N-acyltransferase(lnt) Protein (P44626) (1-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-522) |
Form : | Lyophilized powder |
AA Sequence : | MKNLNRILLSIKFMNKYFTYLIAIISGLLGVFAFSPFDYWPLAYVSLLGLLYVAKNPKKS TALLSTFLWAMGFFCFGVSWLNVSIHQFGGASLGVSYFLVGLLAAYLALYPMLFTYLVHH FKVQSAVIFAVIWTLTEFLRGWIFTGFPWLQFGYTQIDSPFYGIAPIFGVTGLTFFTVWA SAVIFNLVSSLFKTKNLKLVLANALLLIIVGGLSAYSSRIHFVKSVEDKAISVTLAQGNI EQNLKWDPNYFYSTLAIYQKLITENLGKTDLIILPESALPTLENAITPFFEGLERAAKET KTEIMVGTVFQDTKSGKLLNSIMTAGNPDFPYQPNTQNRYNKHHLVPFGEYVPLESILRP LNSVFNLPMSAFQSGEAVQPSLIAKKRAFSPAICYEIIFGEQVRQNLKQDTDYLLTLSND AWFGDSIGPWQHLQMARMRALELGKPLIRATNTGISVFVDAQGKVLAQAPQFIETTLTYK IAPAEGKTPYSVLGNMPLYALSLLFLLLHSMMAFIRRKMNIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; cutE; HI_0302; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | P44626 |
◆ Recombinant Proteins | ||
YODH-1940B | Recombinant Bacillus subtilis YODH protein, His-tagged | +Inquiry |
ABCC2-197M | Recombinant Mouse ABCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF8-1594HA | Recombinant Human TNFRSF8 protein, Fc-tagged, APC labeled | +Inquiry |
LGALS7-290H | Active Recombinant Human LGALS7 protein, His-tagged | +Inquiry |
CUBN-1676R | Recombinant Rat CUBN Protein | +Inquiry |
◆ Native Proteins | ||
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-277H | Human Liver (LT Lobe) Cytoplasmic Lysate | +Inquiry |
IFNA8-001HCL | Recombinant Human IFNA8 Overexpression Lysate(Cys24-Glu189) | +Inquiry |
AGPAT1-36HCL | Recombinant Human AGPAT1 cell lysate | +Inquiry |
HBG2-5619HCL | Recombinant Human HBG2 293 Cell Lysate | +Inquiry |
GRHPR-5749HCL | Recombinant Human GRHPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket