Recombinant Full Length Pseudomonas Aeruginosa Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL5361PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Apolipoprotein N-acyltransferase(lnt) Protein (B7V9D2) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MRWISRPGWPGHLLALAAGALTPLALAPFDYWPLAILSIALLYLGLRGLPGKSALWRGWW YGFGAFGAGTSWIYVSIHDYGAASVPLASLLMLGFTAGVAFFFALPAWLWARCLRRDNAP LGDALAFAALWLALELFRSWFLTGFPWLYAGYSQLQGPLAGLVPVGGVWLSSFVIALSAA LLVNLPRLFPHGASLLLGLVLLLGPWAAGLYLKGHAWTHSAGEPLRVVAIQGNIAQELKW DPNQVRAQLDLYRDLSLPQQDVDLIVWPETAVPILQDMASGYLGAMGQVADEKNAALITG VPVRERLTDGKSRYFNGITVVGEGAGTYLKQKLVPFGEYVPLQDLLRGLIAFFDLPMSDF ARGPADQPLLKAKGYEIAPYICYEVVYPEFAAALAAQSQVLLTVSNDTWFGTSIGPLQHL QMAQMRALESGRWMIRATNNGVTGLIDPYGRIVRQIPQFQQGILRGEVIPMQGLTPYLQY RVWPLAGLAGVLLLWALLGRQLRPQERRLFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; PLES_09911; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | B7V9D2 |
◆ Recombinant Proteins | ||
TMED7-5759R | Recombinant Rat TMED7 Protein, His (Fc)-Avi-tagged | +Inquiry |
YORX-3608B | Recombinant Bacillus subtilis YORX protein, His-tagged | +Inquiry |
TNFSF11-349H | Recombinant Human Tumor Necrosis Factor (ligand) Superfamily, Member 11,His-tagged | +Inquiry |
YOCA-3621B | Recombinant Bacillus subtilis YOCA protein, His-tagged | +Inquiry |
NOL11-5968H | Recombinant Human NOL11 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
C3-08R | Native Rat C3 Protein | +Inquiry |
IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
Serpinc1-5483R | Native Rat Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEG3-3305HCL | Recombinant Human PEG3 293 Cell Lysate | +Inquiry |
DPYS-001HCL | Recombinant Human DPYS cell lysate | +Inquiry |
EIF2C1-6668HCL | Recombinant Human EIF2C1 293 Cell Lysate | +Inquiry |
C8A-7956HCL | Recombinant Human C8A 293 Cell Lysate | +Inquiry |
ACTR2-9050HCL | Recombinant Human ACTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket