Recombinant Full Length Rhodopirellula Baltica Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL18918RF |
Product Overview : | Recombinant Full Length Rhodopirellula baltica Apolipoprotein N-acyltransferase(lnt) Protein (Q7UGJ8) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopirellula baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MRWLSAASSAFAVVLWLSGPPFAIGPLVFIALVPLLAIAEVSPSSSWKRPLYAASLAYWL LSLQGLRYAHPLMFLPWIALSGYLAIYPVLFIALLRRLRLVDNCDVSQARRDRVPLCLVA AVVWVGLEWIRNYFFTGISVLMLGHALADMPMLIQIADLGGTYAVSFVIVCVNVAMFDAL NRWVVQRTSSVSDSPMKSLVTAGGLLIATMVYGAMSMNAETEPTGKTIALLGDNELTVYE QDIVREQEIFATYGQMAIDAVAKSNTRIDAVVWPESMFSGGLPWMTTGADLVVPDFMQNP AAAPLQPEQLRFAVESKQNDFLDRANSIQRAMRASSTVPTEAPPAIIGGCGLVQYADRPS QYSGVVWVNATGNMSGTYSKNHLVLFGETIPLVHSLPWIRDIVPPGLGLDRGTQPERFDL DGISLMPNLCIETAVERIPVNHMHQLNSRANPKLPDAIVTLTNDVWFHDSAVVDHHLRCA QLVAVGCRRPILSAANGGPTVWIDSAGRVVERLAKGQSDVIYAQPRRDSRISLYVRIGSW PAGLMGAATLCGLAWMTFEWLMRRRKRSVIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RB5177; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7UGJ8 |
◆ Native Proteins | ||
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
Factor Ixa-62H | Native Human Factor Ixa | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREM-7284HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
SMPD1-702HCL | Recombinant Human SMPD1 cell lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
TADA3-1278HCL | Recombinant Human TADA3 293 Cell Lysate | +Inquiry |
HIST1H2BB-5542HCL | Recombinant Human HIST1H2BB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket