Recombinant Full Length Chromobacterium Violaceum Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL5314CF |
Product Overview : | Recombinant Full Length Chromobacterium violaceum Apolipoprotein N-acyltransferase(lnt) Protein (Q7NQI3) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chromobacterium violaceum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MLNAAGGAGCDPSSPTATSPMRILILLLAAALAGAFTLFAFAPYRLFWLMPLCLAALVEL LQREPRRAFWLGYAWGLGAYVSNFRWIYDSLHDVAGLPAWIAAPLVLLLPAYLALYPGLA SWLACRIDPRPGVRWLLAFPAAWELGEWLRGWVMTGFPWGAAGYSQITESPLAGYAPLGG IHLVNYLVALSAAALAMLARAGMRQRIGILIAAALAWGSGVWLRDIEWTTPAGKPITVAL AQGNIAQELKWSPENLENSLLTYYRQVAMTRADLMILPETALPLFLDDLPSGYLSMMRGE ASRAGMALASGIPRRTDDGRGYLNSVVALSDPKMPYYAKDHLVPFGEFVPLPGLIGWIYQ HMDMPLSGFTRGGADQPPLTLAGQKVAFNVCYEDSFGEELIGPASRAGMLANVSNLAWFG KSEAMSQHLQLSQARSLETGRYMLRATNNGMTAIIRPDGEISAVAAPFTAQVLTGFAQSR QGLTPYMRFGNLPVVLGCGALLLLALLLGWRRRGQH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; CV_4154; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7NQI3 |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA4D-2038HCL | Recombinant Human SEMA4D cell lysate | +Inquiry |
Corpus Callosum-18H | Human Corpus Callosum Tissue Lysate | +Inquiry |
GREM1-001MCL | Recombinant Mouse GREM1 cell lysate | +Inquiry |
MSL3-4113HCL | Recombinant Human MSL3 293 Cell Lysate | +Inquiry |
ZNF189-1991HCL | Recombinant Human ZNF189 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket