Recombinant Full Length Pseudomonas Putida Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL19427PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Apolipoprotein N-acyltransferase(lnt) Protein (Q88DN4) (1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-505) |
Form : | Lyophilized powder |
AA Sequence : | MRWITRPGWPGNLLALAAGASTLLALAPFDIWPLAVLSIAVLYLGLRELSPRQAMWRGWW FGFGLYGAGTWWIYVSMNTYGGASPLLAIVLLLAFFAALAWFFALPTWLWARWLRRNEAP LADALCFAALWLLQEAFRGWFLTGFPWLYAGYSQLDGPLAGLAPLGGVWLISFTLALTAA LLCNLHRLRPRPSFLAVASVLLLAPWGLGLALKGHAWTIPAGDPLKVAAIQGNVEQDLKW DPAHIDAQLALYRDLSFSSRPVDLLVWPETAVPVLKDQAQGYIDVMGRFAAERHSALITG VPVREEVHHQRRYYNGITVTGEGDGTYLKQKLVPFGEYVPLQDVLRGAIEFFNLPMSDFA RGPEDQPLLQAKGYQIAPYICYEVVYPEFAAGLAARSDLLLTISNDTWFGKSIGPLQHLQ MAQMRALEAGRWMIRATNNGVTALIDPFGRITTQIPQFQQAVLYGEVVPMQQLTPYLQWR SWPLAIVCALLLGWALLAGRIAKTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; PP_4790; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q88DN4 |
◆ Recombinant Proteins | ||
CACNB2-601R | Recombinant Rhesus monkey CACNB2 Protein, His-tagged | +Inquiry |
RFL10527NF | Recombinant Full Length Nicotiana Tabacum Cytochrome B5 Protein, His-Tagged | +Inquiry |
Mrpl32-4152M | Recombinant Mouse Mrpl32 Protein, Myc/DDK-tagged | +Inquiry |
IL22RA2-439H | Recombinant Human IL22RA2 Protein (Met1-Pro263), His-tagged | +Inquiry |
MPXV-0333 | Recombinant Monkeypox Virus C3L Protein | +Inquiry |
◆ Native Proteins | ||
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G15-3144HCL | Recombinant Human PLA2G15 293 Cell Lysate | +Inquiry |
ES-D3-573M | ES-D3 (mouse pluripotent embryonic stem cell) whole cell lysate | +Inquiry |
FMO2-6183HCL | Recombinant Human FMO2 293 Cell Lysate | +Inquiry |
C16orf59-8249HCL | Recombinant Human C16orf59 293 Cell Lysate | +Inquiry |
NOL6-1202HCL | Recombinant Human NOL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket