Recombinant Full Length Rhodoferax Ferrireducens Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL24107RF |
Product Overview : | Recombinant Full Length Rhodoferax ferrireducens Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q21WN9) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodoferax ferrireducens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MTKPISLSNRALYARLLSYVRPYWKAVFLAVIGMVGTAATEPVFPAIMKYLLDNGFQAKD ARMVWLIPMGIVTLFLVRSVIVYCTGYLMTWISSRLVTDLRRTMFAKLLALPTHHYDEHS AGQMISRLVYDVSNVTDAATSALITLVRESLTAIALIGYLLYLDWKLTLITLAIGPVIAF TVKSFSKRMRAASQKSLQAMRFISHTIEETISAQQVVKIFGGQERQQKQFFEATEQFRRA QMREAIPASAMTPITHIAASVAVAIIAFLALSQSTGQAGASAGSFISFITAMLMLISPVK QLATVNPTIQRGLAASESIFELLDAAQEDDRGKRQLLRSKGEICFDNVSLRYLGAERFAL NDISFRITAGQTVALVGASGGGKSTISALIPRFYPVTSGRVLVDGIDINDITLASLRQNI ALVSQNVILFNDTVGANIAYGSLQTCSRDDVIRAARAANAWDFIEQLPNGLDTPIGENGA KLSGGQRQRLAIARALLKDAPILILDEATSALDTESERQVQAALAVLMKNRTTLVIAHRL STIEHADCILVLDQGRIVETGTHAELLRAGSYYANLSRLQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Rfer_2090; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q21WN9 |
◆ Recombinant Proteins | ||
RFL29481OF | Recombinant Full Length Rabbit Substance-K Receptor(Tacr2) Protein, His-Tagged | +Inquiry |
RFL3790SF | Recombinant Full Length Pig Alpha-1D Adrenergic Receptor(Adra1D) Protein, His-Tagged | +Inquiry |
TRMT6-2721C | Recombinant Chicken TRMT6 | +Inquiry |
ALPK1-327H | Recombinant Human ALPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHAF1-14802M | Recombinant Mouse SDHAF1 Protein | +Inquiry |
◆ Native Proteins | ||
PR-01H | Native HIV1 PR Protein | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM39-2470HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
LECT1-4780HCL | Recombinant Human LECT1 293 Cell Lysate | +Inquiry |
DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
IDI1-834HCL | Recombinant Human IDI1 cell lysate | +Inquiry |
CCT4-7688HCL | Recombinant Human CCT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket