Recombinant Full Length Rhizobium Sp. Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL32426SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Apolipoprotein N-acyltransferase(lnt) Protein (C3MF13) (1-531aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-531) |
Form : | Lyophilized powder |
AA Sequence : | MERLAGKIILLSGASRAFVGFLAGLLAMFAQPPFGIFAAAFISFPMLVWLIDGVATHPDE GVVRRLLPAASIGWSFGFGYFLGGLWWLGNAFLVEADLFAWAMPLAVVGLPAVLALFYAL AVLVARCLWSDGVGRIAALAVGFGVAEWLRSFLFTGFPWNAIGYAAMPMPLMMQSASVLN VATINMLAVFVFAAPALIGTGKGARVGLAVAAALFAAHIGYGYYRLSLPPPQPLTPERTV RLVQPVIDQAKKMDDRERAVIFEEHLALTAAPPQAGGKRPDIVVWPETSIPFILTDNPDA LARIADVLQDGQILVAGAVRAEDAGTGLPPRYYNSIYVIDDRGQIVGASDKVHLVPFGEY LPFEDVLNSWGLSSIAANMPGGFSAASNRSVLTLPGGRTFYPLICYEAIFADEVDGSARL SDALLNVTNDAWFGDTPGPRQHFHQAQLRTIETGLPMIRAANTGISAIVDARGVLVVGLG YNYKGVTDAILPGKMPTMTDSMLRGRIFWFTGVFLLLVAAISRRGLNFRTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; NGR_c00460; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | C3MF13 |
◆ Recombinant Proteins | ||
IL1RAPL2-3551H | Recombinant Human IL1RAPL2 Protein (Ser161-Thr330), N-His tagged | +Inquiry |
FABP7-1838H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
TAS2R5-4625R | Recombinant Rhesus monkey TAS2R5 Protein, His-tagged | +Inquiry |
EGR1-1399R | Recombinant Rhesus monkey EGR1 Protein, His-tagged | +Inquiry |
RFL18209RF | Recombinant Full Length Rat Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Serpinc1-5483R | Native Rat Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
Fetus-186M | Mouse Fetus (15 Day Fetus) Membrane Lysate | +Inquiry |
COA3-7759HCL | Recombinant Human CCDC56 293 Cell Lysate | +Inquiry |
IRX2-873HCL | Recombinant Human IRX2 cell lysate | +Inquiry |
APOBEC3C-95HCL | Recombinant Human APOBEC3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket