Recombinant Full Length Nitrosomonas Europaea Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL5015NF |
Product Overview : | Recombinant Full Length Nitrosomonas europaea Apolipoprotein N-acyltransferase(lnt) Protein (Q820C9) (1-497aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrosomonas europaea |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-497) |
Form : | Lyophilized powder |
AA Sequence : | MNGYFRLIAAFALGVATVSGFAPFYLYPIPVVTLALLALLWRRSRTPGQAALTGFTFGMG LFGAGVTWLYVSLHDFGHMEPALAVLALIILCAYLALFPALTGWITAFRHFRASWAWPGM VAALWALAEWLRGTLFTGFPWLTVGYSQAPASPLAGFAPVIGVYGLSLLLMLSAAWLACW LENRQSHRFWLGLGSVWLIGFGLQQIHWTQPEGEPVTVSLLQGNIPQNMKWQPEHLAATM QIYAELVQESPSRLIVTPEISFPLFYEQAPQDYLALLAEHARSRQGDLLIGMAERSSSDN GYYNTMFSFGTSPEQSYRKYHLVPFGEYIPLKPVFGWIIDVLHIPLSDFSRGGLDQQPLD LAGQQVAVNICYEDVFGEEIIMQLPQASLLVNVSNDAWFGRSIGPRQHLQISQMRALETG RYMLRATNTGVTAIIDERGRVLEQLDMFTTAGLHSTAQGFGGATPYVRFGNSLVFALIGL LLLAGSLAAFSGRRKTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; NE1188; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q820C9 |
◆ Recombinant Proteins | ||
TMEM174-4599R | Recombinant Rhesus Macaque TMEM174 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERG11-1951S | Recombinant Saccharomyces Cerevisiae ERG11 Protein (1-20 aa), GST-tagged | +Inquiry |
YNCC-2445B | Recombinant Bacillus subtilis YNCC protein, His-tagged | +Inquiry |
PSCA-5744H | Recombinant Human PSCA protein, hFc-tagged | +Inquiry |
Aqp9-1672M | Recombinant Mouse Aqp9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
COD-39 | Active Native Choline oxidase | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMF1-3089HCL | Recombinant Human PMF1 293 Cell Lysate | +Inquiry |
IFT122-5276HCL | Recombinant Human IFT122 293 Cell Lysate | +Inquiry |
ANXA4-8831HCL | Recombinant Human ANXA4 293 Cell Lysate | +Inquiry |
IL12RB2-2142MCL | Recombinant Mouse IL12RB2 cell lysate | +Inquiry |
PEF1-3308HCL | Recombinant Human PEF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket