Recombinant Full Length Rickettsia Bellii Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL5520RF |
Product Overview : | Recombinant Full Length Rickettsia bellii Apolipoprotein N-acyltransferase(lnt) Protein (Q1RH27) (1-499aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia bellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-499) |
Form : | Lyophilized powder |
AA Sequence : | MYKPKISCLLLGLLSGLVFAPTFLLPALLTLSYLCCLVQKSKDWQEAAKLGYIFGFGHFL SGIYWISIGVSVYISDFWWAIPFALFGLPIILAFFVSASCVFSFFVRNNKYYHFIFCLYW VLFEWVRSWIFTGLPWNLIGYAFSFSDILIQSLNIIGIYGLSFIVIYISTSFYPFFTKQF DQLKVLLLTSSITLAVIITYGSVRLHNHPTNFTDIKVRLVQPSIPQTEKWSEEEFWHNLM LHINLSENSQPIDLVIWSEAALVVPYDIPVVKSELLGLLNSVDATLITGGISDNKKRGED FELYTAMYALEKNGNKLFEYHKSHLVPFGEYMPFKKILPFKKLTHGFVDYTEGNGGLVYL DKYNLKIKPLICYESIFPDFVRTNNETADVIINVTNDAWYGKSSGPYQHFHISRSRAVEN GLPMVRVANNGISAIIDPLGRVIKKLDLNEINYIDGLIPKKLDSPTIFSKFGNITILLIV FFIFLVNYLLDKKLINSRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RBE_1256; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q1RH27 |
◆ Recombinant Proteins | ||
MS4A1-17HF | Active Recombinant Human MS4A1 Protein, Fc-tagged, FITC conjugated | +Inquiry |
Prtg-5167M | Recombinant Mouse Prtg Protein, Myc/DDK-tagged | +Inquiry |
ELOVL6-5152M | Recombinant Mouse ELOVL6 Protein | +Inquiry |
ZDHHC9-6092Z | Recombinant Zebrafish ZDHHC9 | +Inquiry |
PFKL-12664M | Recombinant Mouse PFKL Protein | +Inquiry |
◆ Native Proteins | ||
TFRC-69H | Native Human Apotransferrin | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
C4-12H | Active Native Human C4 protein | +Inquiry |
TF-8271H | Native Human Serum Transferrin APO (Iron Free) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSA-2399MCL | Recombinant Mouse CTSA cell lysate | +Inquiry |
MEIS2-4372HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Bladder-131R | Rat Bladder Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket