Recombinant Full Length Human Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL31664HF |
Product Overview : | Recombinant Full Length Human Protein tweety homolog 1(TTYH1) Protein (Q9H313) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGSKIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVS QLSSALLHANHTLSTIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE AAAQQLQGLAFWQGVPLSPLQVAENVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYY LLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN FHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTYH1 |
Synonyms | TTYH1; Protein tweety homolog 1; hTTY1 |
UniProt ID | Q9H313 |
◆ Native Proteins | ||
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COLEC11-001MCL | Recombinant Mouse COLEC11 cell lysate | +Inquiry |
INF2-5209HCL | Recombinant Human INF2 293 Cell Lysate | +Inquiry |
REG3B-999MCL | Recombinant Mouse REG3B cell lysate | +Inquiry |
TM2D2-1038HCL | Recombinant Human TM2D2 293 Cell Lysate | +Inquiry |
ChoroidsPlexus-425S | Sheep Choroids Plexus Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTYH1 Products
Required fields are marked with *
My Review for All TTYH1 Products
Required fields are marked with *
0
Inquiry Basket