Recombinant Full Length Pseudomonas Putida Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL18462PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q88F88) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MATPLIELCDIRKAYGGVDTPRVEVLRGISLRVHAGEFVAIVGASGSGKSTLMNILGCLD RPSAGSYRFAGKDVAELDSDELAWLRREAFGFVFQGYHLIPSGSAQENVEMPAIYAGTPA AERQARASALLGRLGLASRTANRPHQLSGGQQQRVSIARALMNGGHIILADEPTGALDSH SGAEVMALLDELASQGHVIILITHDREVAARAHRVIEIRDGLVISDSAADQPPAHAHKGI QAEELRQRLDRGATQHGAWKGELLESLQAAWRVMWINRFRTALTLLGIIIGVASVVVMLA VGEGSKRQVMAQMAAFGSNILYLNGSPPTLREPAGRITLDDVAAIGELPQVKHIMPVLGE KMMVRHGNNSQQFYVGGNNTFFPEIFNWPAVEGSFFTETDEASSAAVAVIGQKVREKMLA PGSNPIGQYLLIGNVPFQVVGILAGKGASSGDQDSDGRIVVPFSAAAIRLFGHRDPDYIA IAARDSGQVKDTEAAIDRLLRQRHQGKHDFELTNDAALIQAEARTQNSLSLMLGAIAAIS LLVGGIGVMNIMLMTVRERTREIGIRMATGARQRDILRQFLSEAIMLSMVGGLTGIALAL VVGASLTLADIAVAFALPAIVGAFACAVITGVVFGFMPARKAARLDPVKALTSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; PP_4210; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q88F88 |
◆ Recombinant Proteins | ||
LTA-2131HFL | Recombinant Full Length Human LTA Protein, C-Flag-tagged | +Inquiry |
RASGRF2B-6808Z | Recombinant Zebrafish RASGRF2B | +Inquiry |
TINAGL1-4065Z | Recombinant Zebrafish TINAGL1 | +Inquiry |
VRTN-4602Z | Recombinant Zebrafish VRTN | +Inquiry |
SOX5-659H | Recombinant Human SOX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX16-1599HCL | Recombinant Human SNX16 293 Cell Lysate | +Inquiry |
EFNB2-2405MCL | Recombinant Mouse EFNB2 cell lysate | +Inquiry |
TBX20-1202HCL | Recombinant Human TBX20 293 Cell Lysate | +Inquiry |
SIGLEC15-1847HCL | Recombinant Human SIGLEC15 293 Cell Lysate | +Inquiry |
SEMA4D-001CCL | Recombinant Cynomolgus SEMA4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket