Recombinant Full Length Rhodopseudomonas Palustris Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL21869RF |
Product Overview : | Recombinant Full Length Rhodopseudomonas palustris Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2IXX0) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopseudomonas palustris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MAGSTIELRGLRREFPSGEATVVALQDLDLTIEPGEMVAIMGASGSGKSTLMNILGCLDR PTSGSYRIAGRETSSLEADELSALRREHFGFIFQRYHLLPALSALGNVEIPAIYAGQPGE ARRARAGELLARLGLADRSGHRPNQLSGGQQQRVSIARALMNGADVILADEPTGALDQRS GTEVLQILDELNRDGKTVIIVTHDASVAARAKRVIELRDGVVVADRLTSPEAARRAGDAP TRQPPATPRWNWRREYDRISEATRIAVLAMAAHRLRSFLTMLGIIIGIASVVFVVAVGDA AKRKVLADISSLGTNTIEIFPGKDMGDVRSSKIKTLVAADARALAQQPYIDGVTPTVSTT STLRYGGLEANALVNGVGDQYFDVKGTKLASGRFFDASGLRDIVQDVVIDEKTRQTFFAD VAGGAVGKVILIGKVPCRIVGVMQQQQSGFGSNQNLSVYLPYTTVQARFLGNSSLRSILL KVSDTVATADAEQDVTRFLTLRHRVKDFVILNTDDIRKTITSTTGTLTLMIAAIAVISLV VGGIGVMNIMLVSVSERVGEIGVRMAVGARRSDILQQFLIEAVVVCLIGGGLGVGVAFGL AALFNLVVPMFPLSLSGTSIAAAFVCSTGIGIVFGYLPARQASFLDPLAALSRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; RPB_2235; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2IXX0 |
◆ Native Proteins | ||
Cry1Ac-524 | Native Bacillus thuringiensis Cry1Ac Protein | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Salivary-652B | Bovine Parotid Lysate, Total Protein | +Inquiry |
NCR1-1244RCL | Recombinant Rat NCR1 cell lysate | +Inquiry |
C18orf54-8219HCL | Recombinant Human C18orf54 293 Cell Lysate | +Inquiry |
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
PRAF2-2899HCL | Recombinant Human PRAF2 293 Cell Lysate | +Inquiry |
See All Salivary Parotid Total Protein Cell & Tissue Lysates |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket