Recombinant Full Length Burkholderia Cenocepacia Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL16305BF |
Product Overview : | Recombinant Full Length Burkholderia cenocepacia Macrolide export ATP-binding/permease protein MacB(macB) Protein (A0B212) (1-681aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Cenocepacia |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-681) |
Form : | Lyophilized powder |
AA Sequence : | MRQPLLKLAAVTRRFPAGDKDVVVLNNVNLSIGAGEIVAIVGASGSGKSTLMNILGCLDH PSEGTYTVGGRDTHMLDSDELAQLRREHFGFVFQRYHLLPHVDAVANLEMPAIYAGTPRA DRHARARELLARLGLADRAHHRPGQLSGGQQQRVSIARALMNGGQVILADEPTGALDTKS GQDVIRILHELNALGHTIVIVTHDKAVARHARRIIEISDGEIVADRPNRHYAEAFAEVGV GAAATTETAADTRSAPASGDAPPPANNDTAADPAPRARRFAAGTGRFAEACRMAWIALVS HRLRTLLTMLGIIIGITSVVSIVAVGEGAKRYMLEEIGSIGTNTISLYPGSDWGDSRADT IQTLVPADVAALAEQPYVDSATPETSRTLLLRYRNVDVHALVSGVGDSYFQTRGMRFALG VPFDDDAVRRQAQVAVIDQNTRRKLFGATRNPVGEAILVDNVPCVVIGVTADKKSAFGSV KSLNVWVPYTTASGRLFGQRYLDSITVRVRDGQPSAAAEKSLEKLMIQRHGRKDFFTYNM DSVVKTVEKTGQSLTLLLSLIAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARQSD ILQQFLVEAVLVCLLGGTIGIALSFGLGALFSVFVAQWKMVFSAGAIVTAFVCSTLTGVI FGFMPARNASRLDPIDALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Bcen2424_4954; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | A0B212 |
◆ Recombinant Proteins | ||
COX2-2700H | Recombinant Human COX2 protein, GST-tagged | +Inquiry |
galK-1373T | Recombinant Thermus thermophilus galK Protein (M1-L347), His-tagged | +Inquiry |
SH-RS07010-5814S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS07010 protein, His-tagged | +Inquiry |
PDIA2-6601M | Recombinant Mouse PDIA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSEN15-997H | Recombinant Human TSEN15, His-tagged | +Inquiry |
◆ Native Proteins | ||
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
TF-103H | Native Human Apotransferrin | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN3-2683HCL | Recombinant Human PTPN3 293 Cell Lysate | +Inquiry |
SERPINA6-1948HCL | Recombinant Human SERPINA6 cell lysate | +Inquiry |
Duodenum-573M | MiniPig Duodenum Lysate, Total Protein | +Inquiry |
STARD5-1422HCL | Recombinant Human STARD5 293 Cell Lysate | +Inquiry |
BTBD9-192HCL | Recombinant Human BTBD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket