Recombinant Full Length Bdellovibrio Bacteriovorus Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL13324BF |
Product Overview : | Recombinant Full Length Bdellovibrio bacteriovorus Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q6MPX9) (1-650aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bdellovibrio bacteriovorus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-650) |
Form : | Lyophilized powder |
AA Sequence : | MIDIKGIRKSYQMGDTKVDVLKGISLKIERGDFVAIMGPSGSGKSTLMHILGLLDVPSEG SYNLNGREVADLSEDELAIVRREEIGFIFQQFNLLPRMEAWQNVSLPLIYSEDGFSYDKA QALLDKVGLAERIHHKSNELSGGQQQRIAIARSLINNPRIIFADEPTGNLDSKSEKEIIQ ILHKLNDQGITVIVVTHEEEIGQQAKRLIRLRDGVIQSDERLQALPAAPTTAQEKRQEKT AKWPVREMIEHLHQGFQTLAANKVRSGLSMLGILIGVAAVVGMLALGTGARQSIEKQLSS LGSNLLVLRAGNVRVGGVMQESGVRIRISLDDVSTIKNQISGIKDVSPSSSGRGQITYLN KNWNTQVMGVAPAYEQMRASTPIFGRFFSEEENQRRTLVAVIGTTVARELFGEKSPIGEM IKINKVNFRVIGVLPEKGAAGPQDQDDRILVPVVTAMYRLFGRNYVDSVDIEVRDAADIP EVQDSLQELMNKRHRVPVSSQGDAFNVFNMADIQQALNSTSQTLSMLLASIAAISLVVGG IGIMNIMLVSVTERTKEIGLRKAIGARRRDILLQFLAESIVVSVCGGLLGIALGVGFSLL ISKVLGWSTVVSAGSVILSFGFSALIGIVFGSYPASKASKLHPIEALRYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Bd0709; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q6MPX9 |
◆ Recombinant Proteins | ||
RFL14514BF | Recombinant Full Length Bacillus Clausii Probable Thiol-Disulfide Oxidoreductase Resa(Resa) Protein, His-Tagged | +Inquiry |
SLC5A2-30972TH | Recombinant Human SLC5A2 | +Inquiry |
BCL7C-167H | Recombinant Human BCL7C Protein, GST-tagged | +Inquiry |
GSR-29083TH | Active Recombinant Human GSR protein | +Inquiry |
ZNF767-5390C | Recombinant Chicken ZNF767 | +Inquiry |
◆ Native Proteins | ||
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME2-3790HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
HA-2327HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
Adipose-551M | MiniPig Adipose Tissue Lysate, Total Protein | +Inquiry |
LCE1B-4808HCL | Recombinant Human LCE1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket