Recombinant Full Length Prochlorococcus Marinus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL28735PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Apolipoprotein N-acyltransferase(lnt) Protein (Q7V8K1) (1-499aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-499) |
Form : | Lyophilized powder |
AA Sequence : | MGNDRSLALVQGAVGGVLAGIGIAHGGLLWMAPALALLWSACRFPVAASLWGFVAVLLSH RWLLALHPLTWVGVPAPLSVPVAASIWLFCGAAAAVLVGLWAWLGTSIAHLATREAGIRA QLSHALLMASIWGLAEVLLAGSPLFWIGVGGSLLPGDRALAGLARWFGAGGLATLQLLIG WWLWRTALAWRRGVGWRRSLLVGLLCLLLAHGFGWSLLRSSDATAPISVAAWQPAIPTRS KFSEEQQRRLPEALQNALDRADDLDAAWLVAPEGLLPPDAVLLRPAPLPLLSGGFRWLRG QQRSALLVVDRGERQASAFIDKHRLVPLGEWLPALPGGVFRGLSAVGGLQPGAASRLLQW PGPTAAVAICYELSNGAALAQAVADGAQWLLAVANLDPYPLALQRQFIALAQLRSIETAR DLLSVANTGPSALVLATGKQQQLLAPFTEGVGLADLHFHQGISGYTRWREAPLIGLMLFA VVGLGLSRVRSWLISLMLC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; PMT_0343; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7V8K1 |
◆ Recombinant Proteins | ||
PRKAA1-9836HF | Active Recombinant Full Length Human / AMPK (A1/B1/G1)PRKAA1 Protein, DDK/GST-tagged, Biotinylated | +Inquiry |
DYNLT1F-2589M | Recombinant Mouse DYNLT1F Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA7A-8012M | Recombinant Mouse SEMA7A Protein, His (Fc)-Avi-tagged | +Inquiry |
SURF1-5843R | Recombinant Rat SURF1 Protein | +Inquiry |
RFL25276RF | Recombinant Full Length Rhodothermus Marinus Protein Translocase Subunit Secd(Secd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
HB-01H | Native Human HB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAB8782 | Rabbit Anti-PLGRKT Polyclonal Antibody | +Inquiry |
MTF2-1143HCL | Recombinant Human MTF2 cell lysate | +Inquiry |
CEP76-180HCL | Recombinant Human CEP76 lysate | +Inquiry |
SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
TCTEX1D2-1161HCL | Recombinant Human TCTEX1D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket