Recombinant Full Length Rickettsia Felis Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL31344RF |
Product Overview : | Recombinant Full Length Rickettsia felis Apolipoprotein N-acyltransferase(lnt) Protein (Q4ULZ6) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia felis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MYKPKIICLLLGMLSGLVFAPTFFIPALLTLSYLCYIVQKSENWQEAAKFGYLFGFGHFL SGIYWISIGVSVYIADFWWAIPFALFGLPIVLAFFISASCTLSFFAKNNKYYQFIFCICW VLFEWVRSWIFTGLPWNLIGYAFSFSDILIQTLSIIGIYGLSFIVIYISTSAYPLFRKQF TQLKILLASSVLILSVIVIYGAVRLSNNPTNFTDIKVRLVQPSIPQTEKWNEEEFWHNLM LHINLSENSEPTDLIIWSEAALIVPDDIPQVKSELLQMLNSTNAILITGGISDNKKQGDE FELYSAMYALDKNDHKLFEYHKSHLVPFGEYMPLKKILPFKKLTHGLIDYKEGDGGLVYL EKYNLKIKPLICYESIFPDFVRTNNEIVDVIINITNDAWYGKSSGPYQHFHISRSRAVEN GLPMIRVANNGISAIVDPFGRTIEKLNLNEINYTQGLIPKKLNSPTIFSQFGNFTILLLI VFILLINYLLALILDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RF_0576; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q4ULZ6 |
◆ Native Proteins | ||
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf119-8290HCL | Recombinant Human C14orf119 293 Cell Lysate | +Inquiry |
H1FNT-5665HCL | Recombinant Human H1FNT 293 Cell Lysate | +Inquiry |
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
GIGYF1-5940HCL | Recombinant Human GIGYF1 293 Cell Lysate | +Inquiry |
ECM1-2036MCL | Recombinant Mouse ECM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket