Recombinant Full Length Protein Vird4(Vird4) Protein, His-Tagged
Cat.No. : | RFL6917AF |
Product Overview : | Recombinant Full Length Protein virD4(virD4) Protein (P13464) (1-671aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium rhizogenes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-671) |
Form : | Lyophilized powder |
AA Sequence : | MNSSKITPQRLALSIVCSLAAGFCAASLYATFRHGFNGEAMMTFSVFAFWYETPLYIGHA TPVFFCGLSIIIATSVVVLLSQLIISLRNREHHGTARWAAFGEMRHAGYLQRYNRIKGPV FGKTCGPLWFGNYLTNGEQPHSLVVAPTRAGKGVGVVIPTLLTFKGTVIALDVKGELFEL TSRARKSSGDAVFKFSPLDPERRTHCYNPVLDIAALPPERQFTETRRLAANLITAKGKGA EGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAHLAEESRNKEAQRIFD NMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTCVYLCVSPNDL EVVAPLMRLLFQQVVSILQRSLPGKDERYEVLFLLDEFKHLGKLEAIETAITTIAGYKGR FMFIIQSLSALSGTYDEAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFQARSTSY SQARMFDHNIQISDQGAPLLRPEQVRLLDDKSEIVLIKGQPPLKLRKVRYYSDRMLRRLF ECQIGALPEPASLMLAQDVHQDGQDHLSQQAAVTAALGLGDIDSLVNNGETPTQQNSDMN DEQDNLAIGIYAPQVSVEIDDVVEDANARGVAPVSSVPAEMAPALSAQQQLLGQIIALQQ RYRPVSSNPIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virD4 |
Synonyms | virD4; Protein VirD4 |
UniProt ID | P13464 |
◆ Recombinant Proteins | ||
SAP029A-021-3445S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP029A_021 protein, His-tagged | +Inquiry |
NDUFS7-10547M | Recombinant Mouse NDUFS7 Protein | +Inquiry |
SSP-RS07270-0555S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS07270 protein, His-tagged | +Inquiry |
TRADD-29977TH | Recombinant Human TRADD, His-tagged | +Inquiry |
HAPLN1-4055M | Recombinant Mouse HAPLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2A-6675HCL | Recombinant Human EIF2A 293 Cell Lysate | +Inquiry |
CDC45-7649HCL | Recombinant Human CDC45 293 Cell Lysate | +Inquiry |
SSR1-1459HCL | Recombinant Human SSR1 293 Cell Lysate | +Inquiry |
MTX1-4063HCL | Recombinant Human MTX1 293 Cell Lysate | +Inquiry |
GRAMD1B-309HCL | Recombinant Human GRAMD1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virD4 Products
Required fields are marked with *
My Review for All virD4 Products
Required fields are marked with *
0
Inquiry Basket