Recombinant Full Length Agrobacterium Tumefaciens Protein Vird4(Vird4) Protein, His-Tagged
Cat.No. : | RFL5933AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Protein virD4(virD4) Protein (P18594) (1-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Fabrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-668) |
Form : | Lyophilized powder |
AA Sequence : | MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTFSVFAFWYETPLYMGHA TPVFYCGLAIVVSTSIVVLLSQLIISFRNHEHHGTARWAGFGEMRHAGYLQRYNRIKGPI FGKTCGPRWFGSYLTNGEQPHSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFEL TSRARKAGGDAVFKFSPLDPERRTHCYNPVLDIAALPPERQFTETRRLAANLITAKGKGA EGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAHLAEESRNKEAQRIFD NMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTCVYLCVSPNDL EVVAPLMRLLFQQVVSILQRSLPGKDERHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR FMFIIQSLSALTGIYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFKARSTSY SQARMFDHNIQISDQGAPLLRPEQVRLLDDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLF ECQIGALPEPASLMLSEGVHRDGQDLSQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDD EQDSLPTGIDVPQGLIESDEVKEDAGGVVPDFGVSAEMAPAMIAQQQLLEQIIALQQRYG PASSHSVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virD4 |
Synonyms | virD4; Atu6184; AGR_pTi_23; Protein VirD4 |
UniProt ID | P18594 |
◆ Recombinant Proteins | ||
asd-397L | Recombinant Legionella pneumophila asd protein, His-tagged | +Inquiry |
TLR3-30112TH | Active Recombinant Human TLR3 protein | +Inquiry |
GM4307-3705M | Recombinant Mouse GM4307 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTMT-4534H | Recombinant Human FTMT Protein, GST-tagged | +Inquiry |
CD40LG-2966HF | Recombinant Full Length Human CD40LG Protein | +Inquiry |
◆ Native Proteins | ||
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DRB5-799HCL | Recombinant Human HLA-DRB5 cell lysate | +Inquiry |
NEUROG1-3865HCL | Recombinant Human NEUROG1 293 Cell Lysate | +Inquiry |
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
TRPV4-731HCL | Recombinant Human TRPV4 293 Cell Lysate | +Inquiry |
SH2D1A-1879HCL | Recombinant Human SH2D1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All virD4 Products
Required fields are marked with *
My Review for All virD4 Products
Required fields are marked with *
0
Inquiry Basket