Recombinant Full Length Bartonella Quintana Type Iv Secretion System-Coupling Protein Vird4(Vird4) Protein, His-Tagged
Cat.No. : | RFL23958BF |
Product Overview : | Recombinant Full Length Bartonella quintana Type IV secretion system-coupling protein virD4(virD4) Protein (Q6FYV9) (1-639aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella quintana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-639) |
Form : | Lyophilized powder |
AA Sequence : | MKYTKIQLALILMPIALGALTIFLVPHLLSFMINDLKANHVYWYVRSEPLLVLMLVATVS LCYTLSQKLHLRKAITLVSAVFFGITALYFIGGEIKRLTPYVGQQGITWSYALKFMDPMV VFGVICGVVLLVIQVMISSPPTSKVKRAKKGIFGDASWMNLKEAAKIFPANGQIVVGERY RVDQDGVCNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYPGPIVCLDPSTEIAPMVRFARKKMGNRNVIVLDPNSLLTKNFNVLDWLLDDSVPRTQR EANIVGFSKLLLTDKKSENSSAEYFSTQAHNLLTALLAHVIFSDEYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFSSSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGKYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTVEVTGTNKSRGLSLGKSSYNVNYQQRALILPHEIIQEMRQDEQ IILMQGQPPLRCGRAIYFRRKEMLAAANKNRFAPQAKKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virD4 |
Synonyms | virD4; traG; BQ10640; Type IV secretion system-coupling protein VirD4 |
UniProt ID | Q6FYV9 |
◆ Recombinant Proteins | ||
OR4F6-3022R | Recombinant Rhesus Macaque OR4F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
UHRF2-0416H | Recombinant Human UHRF2 Protein (T419-K648), Tag Free | +Inquiry |
TMEM198-4800R | Recombinant Rhesus monkey TMEM198 Protein, His-tagged | +Inquiry |
APEX2-2309H | Recombinant Human APEX2 Protein, MYC/DDK-tagged | +Inquiry |
UNC5B-556H | Recombinant Human UNC5B Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
STMN1-1397HCL | Recombinant Human STMN1 293 Cell Lysate | +Inquiry |
PTPRC-001MCL | Recombinant Mouse PTPRC cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
KDM5B-4992HCL | Recombinant Human KDM5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virD4 Products
Required fields are marked with *
My Review for All virD4 Products
Required fields are marked with *
0
Inquiry Basket