Recombinant Full Length Bartonella Henselae Type Iv Secretion System-Coupling Protein Vird4(Vird4) Protein, His-Tagged
Cat.No. : | RFL2962BF |
Product Overview : | Recombinant Full Length Bartonella henselae Type IV secretion system-coupling protein virD4(virD4) Protein (Q6G2A8) (1-639aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella Henselae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-639) |
Form : | Lyophilized powder |
AA Sequence : | MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWYVRSEPLLTLMLVAAVS LFYTLSQKLHLRKAITFVSTAFFCITALYYIGSEIKRLNPYVGQQGITWGYALKFMDPMV VFGVILGFVLLAIQVIITSPRTSNVKRAKKGIFGDAAWMNLKEAARIFPSNGQIVIGERY RVDQDNVRNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDPNSLLTKNFNVLDWLLDENIPRTRR EANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLTALLAHVIFSDKYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFASSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTIEVTGTSKSRGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQ IILMQGHPPLRCGRAIYFRRKEMLAATEKNRFAPQAKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virD4 |
Synonyms | virD4; traG; BH13380; Type IV secretion system-coupling protein VirD4 |
UniProt ID | Q6G2A8 |
◆ Recombinant Proteins | ||
TCF4-31H | Recombinant Human TCF4 protein, His-tagged | +Inquiry |
SART1-7905M | Recombinant Mouse SART1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGSF10-4478M | Recombinant Mouse IGSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32552EF | Recombinant Full Length Donkey Atp Synthase Subunit A(Mt-Atp6) Protein, His-Tagged | +Inquiry |
MBNL3-1945C | Recombinant Chicken MBNL3 | +Inquiry |
◆ Native Proteins | ||
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
CTSG-26490TH | Native Human CTSG | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIGX-3194HCL | Recombinant Human PIGX 293 Cell Lysate | +Inquiry |
SKOV3-057WCY | Human Ovarian Carcinoma SKOV3 Whole Cell Lysate | +Inquiry |
HLA-DQB1-5496HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
RBM5-2466HCL | Recombinant Human RBM5 293 Cell Lysate | +Inquiry |
RALY-2540HCL | Recombinant Human RALY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virD4 Products
Required fields are marked with *
My Review for All virD4 Products
Required fields are marked with *
0
Inquiry Basket