Recombinant Full Length Prochlorococcus Marinus Divinyl Chlorophyll A/B Light-Harvesting Protein Pcba(Pcba) Protein, His-Tagged
Cat.No. : | RFL33145PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA(pcbA) Protein (Q7VCF7) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MQTYGNPDVTYGWWAGNSGVTNRSGKFIAAHAAHTGLIAFWAGAFTLFELARFDPSVPMG HQPLIALPHLATLGIGFDEAGTFVGGTTVTAIAIVHLVLSMVYGAGGLLHSLTFPGDMQD SEVLQARKFKLEWDNPDNQTFILGHHLIFLGVANIQFVEWARIHGIWDAAAGSIRQVEYN LNLSSIWNHQFDFLTINNLEDVMGGHAFLAFFMITGGAFHIATKQVGEYTKFKGSGLLSA EAILSWSLAGIGWMAIVAAFWCATNTTVYPVDFFGEVLDLKFGIAPYWVDTVDLPNGAHT SRAWLTNVHYFLGFFYIQGHLWHALRAMGFDFKRVSSAVSNIGTASVTLND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcbA |
Synonyms | pcbA; Pro_0783; Divinyl chlorophyll a/b light-harvesting protein PcbA |
UniProt ID | Q7VCF7 |
◆ Native Proteins | ||
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
KLK4-238H | Native Human Kallikrein | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFCAB3-6709HCL | Recombinant Human EFCAB3 293 Cell Lysate | +Inquiry |
KAT8-1162HCL | Recombinant Human KAT8 cell lysate | +Inquiry |
Raji-407H | Human Raji Cytoplasmic Lysate | +Inquiry |
MMADHC-4283HCL | Recombinant Human MMADHC 293 Cell Lysate | +Inquiry |
SYTL4-1297HCL | Recombinant Human SYTL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcbA Products
Required fields are marked with *
My Review for All pcbA Products
Required fields are marked with *
0
Inquiry Basket