Recombinant Full Length Putative Mycofactocin Biosynthesis Glycosyltransferase Mftf(Mftf) Protein, His-Tagged
Cat.No. : | RFL14925HF |
Product Overview : | Recombinant Full Length Putative mycofactocin biosynthesis glycosyltransferase MftF(mftF) Protein (P95042) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MTATRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLRLAPAARGLLCDGRLKVRDEVSAE LARILLDATVAHPRPPSGPSHRDVTVVIPVRNNASGLRRLVTSLRGLRVIVVDDGSACPV ESDDFVGAHCDIEVLHHPHSKGPAAARNTGLAACTTDFVAFLDSDVTPRRGWLESLLGHF CDPTVALVAPRIVSLVEGENPVARYEALHSSLDLGQREAPVLPHSTVSYVPSAAIVCRSS AIRDVGGFDETMHSGEDVDLCWRLIEAGARLRYEPIALVAHDHRTQLRDWIARKAFYGGS AAPLAVRHPDKTAPLVISGGALMAWILMSIGTGLGRLASLVIAVLTGRRIARAMRCAETS FLDVLAVATRGLWAAALQLASAICRHYWPLALLAAILSRRCRRVVLIAAVVDGVVDWLRR REGADDDAEPIGPLTYLVLKRVDDLAYGAGLWYGVVRERNIGALKPQIRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative mycofactocin biosynthesis glycosyltransferase MftF(mftF) |
UniProt ID | P95042 |
◆ Recombinant Proteins | ||
Spike-5753V | Recombinant COVID-19 Spike S1 (N501Y) protein, His-tagged | +Inquiry |
PDCD1LG2-375H | Active Recombinant Human PDCD1LG2 protein, mFc-tagged | +Inquiry |
HGF-8535H | Active Recombinant Human HGF | +Inquiry |
TPI1-7001C | Recombinant Chicken TPI1 | +Inquiry |
RFL18690HF | Recombinant Full Length Human Prolactin Receptor(Prlr) Protein, His&Myc-Tagged | +Inquiry |
◆ Native Proteins | ||
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST1-1930HCL | Recombinant Human CST1 cell lysate | +Inquiry |
HA-2323HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Spleen-476H | Human Spleen Membrane Lysate | +Inquiry |
RPS17-560HCL | Recombinant Human RPS17 lysate | +Inquiry |
SNRPA1-1618HCL | Recombinant Human SNRPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Putative mycofactocin biosynthesis glycosyltransferase MftF(mftF) Products
Required fields are marked with *
My Review for All Putative mycofactocin biosynthesis glycosyltransferase MftF(mftF) Products
Required fields are marked with *
0
Inquiry Basket