Recombinant Full Length Porcine Torovirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL2559PF |
Product Overview : | Recombinant Full Length Porcine torovirus Hemagglutinin-esterase(HE) Protein (Q70KP1) (28-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine torovirus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (28-430) |
Form : | Lyophilized powder |
AA Sequence : | KPITPHYGPGHITSDWCGFGDSRSDCGNQHTPKSLDIPQELCPKFSSRTGSSMFISMHWN NDSDFNAFGYSNCGVEKVFYEGVNFSPYRNYTCYQEGSFGWVSNKVGFYSKLYSMASTSR CIKLINLDPPTNFTNYRNGTCTGNGGTAKMPDNPQLVIFNSVVKVSTQFVLPSSSDGFSC TKHLVPFCYIDGGCFEMSGVCYPFGYYYQSPSFYHAFYTNGTAGLHRYICDYLEMKPGVY NATTFGKFLIYPTKSYCMDTMNYTVPVQAVQSIWSENRQSDDAIGQACKSPYCIFYNKTK PYLAPNGADENHGDEEVRQMMQGLLVNSSCVSPQGSTPLALYSSEMIYTPNYGSCPQYYK LFETSSDENVDVTSSAYFVATWVLLVLVIILIFILISFCLSSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q70KP1 |
◆ Recombinant Proteins | ||
CPSF2-2871C | Recombinant Chicken CPSF2 | +Inquiry |
MCR_0078-82M | Recombinant Moraxella catarrhalis MCR_0078 Protein | +Inquiry |
RFL15766ZF | Recombinant Full Length Zea Mays Casp-Like Protein 3 Protein, His-Tagged | +Inquiry |
RFL31072SF | Recombinant Full Length Staphylococcus Aureus Upf0344 Protein Mw0851(Mw0851) Protein, His-Tagged | +Inquiry |
Eda-979M | Active Recombinant Mouse Eda Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
KLH-83 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP7-2455HCL | Recombinant Human RBP7 293 Cell Lysate | +Inquiry |
Bladder-29C | Cynomolgus monkey Bladder Lysate | +Inquiry |
Spleen-675H | Hamster Spleen Lysate, Total Protein | +Inquiry |
PRDM15-1410HCL | Recombinant Human PRDM15 cell lysate | +Inquiry |
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket