Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL4957BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (Q9QAR6) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQLYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNAMQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPIILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q9QAR6 |
◆ Recombinant Proteins | ||
NP-1738L | Recombinant LCMV NP Protein | +Inquiry |
ATP5F1A-3978H | Recombinant Human ATP5F1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POLR1B-10811Z | Recombinant Zebrafish POLR1B | +Inquiry |
STAT4-2898H | Recombinant Human STAT4 Protein, MYC/DDK-tagged | +Inquiry |
EXOC5-2168R | Recombinant Rat EXOC5 Protein | +Inquiry |
◆ Native Proteins | ||
PLG -37D | Native Canine plasminogen | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
MSLN-1316HCL | Recombinant Human MSLN cell lysate | +Inquiry |
IL18R1-001CCL | Recombinant Cynomolgus IL18R1 cell lysate | +Inquiry |
KCND1-5069HCL | Recombinant Human KCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket