Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL25922BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (Q9DR81) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTTNPRNYSYMDLNPALCGSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPIIFLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q9DR81 |
◆ Recombinant Proteins | ||
Gdpgp1-3186M | Recombinant Mouse Gdpgp1 Protein, Myc/DDK-tagged | +Inquiry |
RFL13373RF | Recombinant Full Length Rat Tumor Necrosis Factor Receptor Superfamily Member 4(Tnfrsf4) Protein, His-Tagged | +Inquiry |
OTOA-2169H | Recombinant Human OTOA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC5A7-4081H | Recombinant Human SLC5A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD33-205H | Recombinant Human CD33 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPX-2279MCL | Recombinant Mouse HPX cell lysate | +Inquiry |
SDPR-1577HCL | Recombinant Human SDPR cell lysate | +Inquiry |
PSMD10-2756HCL | Recombinant Human PSMD10 293 Cell Lysate | +Inquiry |
C2orf65-8066HCL | Recombinant Human C2orf65 293 Cell Lysate | +Inquiry |
BPGM-8417HCL | Recombinant Human BPGM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket