Recombinant Full Length Puffinosis Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL31879PF |
Product Overview : | Recombinant Full Length Puffinosis coronavirus Hemagglutinin-esterase(HE) Protein (O91262) (25-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Puffinosis coronavirus (PV) (Puffinosis virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-439) |
Form : | Lyophilized powder |
AA Sequence : | FNEPLNVVSHLSDDWFLFGDSRSDCSYVENNGHPAFDWLDLPQELCHSGKISAKSGNSLF KSFHFTDWYNYTGEGDQVIFYEGVNFSPSHGFKCLAEGDNKRWMGNKARFYALVYKKMAY YRSLSFVNVSYSYGGKAKPTAICKDNTLTLNNPTFISKESNYVDYYYESDANFTLEGCDE FIVPLCVFNGHSRGSSSDPANKYYMDSQMYYNMDTGVFYGFNSTLDVGNTAQNPGLDLTC IYYALTPGNYKAVSLEYLLTIPSKAICLRKPKRFMPVQVVDSRWNNAKHSDNMTAVACQT PYCLFRNTSSGYNGSTHDVHHGGFHFRKLLSGLLYNVSCIAQQGAFFYNNVSSQWPVLGY GQCPTAANIEFIAPVCLYDPLPVILLGVLLGIAVLIIVFLLFYFMTDSGVRLHEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | O91262 |
◆ Recombinant Proteins | ||
MYL9B-12418Z | Recombinant Zebrafish MYL9B | +Inquiry |
MYL1-5806H | Recombinant Human MYL1 Protein, GST-tagged | +Inquiry |
RAF1-2161H | Recombinant Human RAF1, GST-tagged | +Inquiry |
FLID-1247B | Recombinant Bacillus subtilis FLID protein, His-tagged | +Inquiry |
Tmsb10-6529M | Recombinant Mouse Tmsb10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1R-823RCL | Recombinant Rat CSF1R cell lysate | +Inquiry |
CHRM2-7520HCL | Recombinant Human CHRM2 293 Cell Lysate | +Inquiry |
PNMA6A-3077HCL | Recombinant Human PNMA6A 293 Cell Lysate | +Inquiry |
WDR66-1928HCL | Recombinant Human WDR66 cell lysate | +Inquiry |
C2orf69-8065HCL | Recombinant Human C2orf69 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket