Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL30795BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P31613) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN NPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P31613 |
◆ Recombinant Proteins | ||
Arsa-654M | Recombinant Mouse Arsa Protein, MYC/DDK-tagged | +Inquiry |
ID4-14045H | Recombinant Human ID4, His-tagged | +Inquiry |
MTR1A-1126HFL | Recombinant Human MTR1A protein, His&Flag-tagged | +Inquiry |
RFL23830MF | Recombinant Full Length Mouse Selection And Upkeep Of Intraepithelial T-Cells Protein 4(Skint4) Protein, His-Tagged | +Inquiry |
ENPP6-1141H | Recombinant Human ENPP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRN4CL-1005HCL | Recombinant Human LRRN4CL cell lysate | +Inquiry |
PCDHB6-3390HCL | Recombinant Human PCDHB6 293 Cell Lysate | +Inquiry |
USP44-454HCL | Recombinant Human USP44 293 Cell Lysate | +Inquiry |
SFTPD-2675MCL | Recombinant Mouse SFTPD cell lysate | +Inquiry |
LOC541469-4681HCL | Recombinant Human LOC541469 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket