Recombinant Full Length Pongo Abelii Tetraspanin-4(Tspan4) Protein, His-Tagged
Cat.No. : | RFL24471PF |
Product Overview : | Recombinant Full Length Pongo abelii Tetraspanin-4(TSPAN4) Protein (Q5RAP3) (1-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-238) |
Form : | Lyophilized powder |
AA Sequence : | MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQRDLK KGLHLYGTQGNVGLTNAWTIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN4 |
Synonyms | TSPAN4; Tetraspanin-4; Tspan-4 |
UniProt ID | Q5RAP3 |
◆ Recombinant Proteins | ||
RFL9349MF | Recombinant Full Length Mouse Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
TSPAN4-3856H | Recombinant Human TSPAN4 protein, His-tagged | +Inquiry |
RFL23946HF | Recombinant Full Length Human Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
RFL24471PF | Recombinant Full Length Pongo Abelii Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN4-708HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
TSPAN4-707HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSPAN4 Products
Required fields are marked with *
My Review for All TSPAN4 Products
Required fields are marked with *
0
Inquiry Basket