Recombinant Human TSPAN4 protein, GST-tagged

• Cat.No.: TSPAN4-5745H
• Product Overview: Recombinant Human TSPAN4 protein(96-212 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 96-212 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: LEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCT
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TSPAN4 tetraspanin 4 [ Homo sapiens ]
• Official Symbol: TSPAN4
• Synonyms: TSPAN4; tetraspanin 4; TM4SF7, transmembrane 4 superfamily member 7; tetraspanin-4; NAG 2; TETRASPAN; TSPAN 4; novel antigen 2; tetraspan TM4SF; transmembrane 4 superfamily member 7; NAG2; NAG-2; TM4SF7; TSPAN-4
• mRNA Refseq: NM_001025234
• Protein Refseq: NP_001020405
• MIM: 602644
• UniProt ID: O14817
• Gene ID: 7106