Recombinant Full Length Platanus Occidentalis Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL14574PF |
Product Overview : | Recombinant Full Length Platanus occidentalis Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q09G20) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Platanus occidentalis (Sycamore) (American plane tree) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q09G20 |
◆ Recombinant Proteins | ||
KCNRG-1238H | Recombinant Human KCNRG Protein, His (Fc)-Avi-tagged | +Inquiry |
Spike-5747V | Recombinant COVID-19 Spike S Trimer protein, His-Avi-tagged, Biotinylated | +Inquiry |
UGDH-4910R | Recombinant Rhesus Macaque UGDH Protein, His (Fc)-Avi-tagged | +Inquiry |
FCN3-4766HF | Recombinant Full Length Human FCN3 Protein, GST-tagged | +Inquiry |
Germin-3980B | Recombinant Barley Germin protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
Laminin-01H | Native Human Laminin Protein | +Inquiry |
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VANGL2-432HCL | Recombinant Human VANGL2 293 Cell Lysate | +Inquiry |
USP45-453HCL | Recombinant Human USP45 293 Cell Lysate | +Inquiry |
APOBEC3F-8785HCL | Recombinant Human APOBEC3F 293 Cell Lysate | +Inquiry |
BET1-8465HCL | Recombinant Human BET1 293 Cell Lysate | +Inquiry |
HA-2660HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket