Recombinant Full Length Atropa Belladonna Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL8814AF |
Product Overview : | Recombinant Full Length Atropa belladonna Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q7FNS4) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Atropa belladonna (Belladonna) (Deadly nightshade) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q7FNS4 |
◆ Recombinant Proteins | ||
PTPRE-4498R | Recombinant Rat PTPRE Protein, His (Fc)-Avi-tagged | +Inquiry |
RABGGTB-4565R | Recombinant Rat RABGGTB Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM138-5232C | Recombinant Chicken TMEM138 | +Inquiry |
FGFR1-210H | Recombinant Human FGFR1 protein, DDK/His-tagged | +Inquiry |
Cadm1-1931M | Recombinant Mouse Cadm1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
MFGE8-289B | Native MFG-E8 | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM8A-927HCL | Recombinant Human TMEM8A 293 Cell Lysate | +Inquiry |
LPPR2-4662HCL | Recombinant Human LPPR2 293 Cell Lysate | +Inquiry |
UBE2H-575HCL | Recombinant Human UBE2H 293 Cell Lysate | +Inquiry |
MRPS18B-4148HCL | Recombinant Human MRPS18B 293 Cell Lysate | +Inquiry |
SLC9A8-1692HCL | Recombinant Human SLC9A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket