Recombinant Full Length Arabis Hirsuta Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL3904AF |
Product Overview : | Recombinant Full Length Arabis hirsuta Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QK44) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSVSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QK44 |
◆ Native Proteins | ||
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFAF2-436HCL | Recombinant Human NDUFAF2 lysate | +Inquiry |
TIGD1-1077HCL | Recombinant Human TIGD1 293 Cell Lysate | +Inquiry |
SDC1-2089MCL | Recombinant Mouse SDC1 cell lysate | +Inquiry |
PTPRN2-1441HCL | Recombinant Human PTPRN2 cell lysate | +Inquiry |
LRRC46-4628HCL | Recombinant Human LRRC46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket