Recombinant Full Length Marchantia Polymorpha Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL12556MF |
Product Overview : | Recombinant Full Length Marchantia polymorpha Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P06412) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Marchantia polymorpha (Liverwort) (Marchantia aquatica) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFAFGAFHVTGLFGPGIWISDPYGLTGKVQP VAPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSKAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGNELFVRRMP TFFETFPVVLVDEQGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P06412 |
◆ Recombinant Proteins | ||
NOL12-1653H | Recombinant Human NOL12 | +Inquiry |
IL6ST-1055H | Recombinant Human IL6ST Protein, His-tagged | +Inquiry |
PLP2-3476R | Recombinant Rhesus monkey PLP2 Protein, His-tagged | +Inquiry |
Muc5ac-7625M | Recombinant Mouse Muc5ac protein, His-tagged | +Inquiry |
IL22-90M | Recombinant Mouse IL-22 | +Inquiry |
◆ Native Proteins | ||
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
C-type lectin like protein-042H | Native Hen C-type lectin like protein Protein, FITC conjugated | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-001H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
UBASH3B-2142HCL | Recombinant Human UBASH3B cell lysate | +Inquiry |
VAPB-430HCL | Recombinant Human VAPB 293 Cell Lysate | +Inquiry |
PSMC1-2765HCL | Recombinant Human PSMC1 293 Cell Lysate | +Inquiry |
SETBP1-1587HCL | Recombinant Human SETBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket