Recombinant Full Length Pig Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL2114SF |
Product Overview : | Recombinant Full Length Pig Muscarinic acetylcholine receptor M3(CHRM3) Protein (P11483) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MTLHNNNTTSPLFPNISSSWIHGPSDAGLPPGTVTHFGSYNISQAAGNFSSPNGTTSDPL GGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSL KRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGTVDLERKASKLQAQKSMDDGGSF QKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHRM3 |
Synonyms | CHRM3; Muscarinic acetylcholine receptor M3 |
UniProt ID | P11483 |
◆ Recombinant Proteins | ||
OXTR-3211C | Recombinant Chicken OXTR | +Inquiry |
ACBD4-5039H | Recombinant Human ACBD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SEPTIN6-3368H | Recombinant Human SEPTIN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FIBIN-4167H | Recombinant Human FIBIN Protein, GST-tagged | +Inquiry |
SGK196-2804C | Recombinant Chicken SGK196 | +Inquiry |
◆ Native Proteins | ||
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM154A-6420HCL | Recombinant Human FAM154A 293 Cell Lysate | +Inquiry |
CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
OAT-449HCL | Recombinant Human OAT lysate | +Inquiry |
THOP1-529MCL | Recombinant Mouse THOP1 cell lysate | +Inquiry |
PTPDC1-2691HCL | Recombinant Human PTPDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket