Recombinant Human CHRM3 Protein, GST-Tagged

• Cat.No.: CHRM3-1273H
• Product Overview: Human CHRM3 partial ORF (NP_000731, 1 a.a. - 67 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016]
• Molecular Mass: 33.11 kDa
• AA Sequence: MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHRM3 cholinergic receptor, muscarinic 3 [ Homo sapiens ]
• Official Symbol: CHRM3
• Synonyms: CHRM3; cholinergic receptor, muscarinic 3; muscarinic acetylcholine receptor M3; acetylcholine receptor; muscarinic 3; m3 muscarinic receptor; acetylcholine receptor, muscarinic 3; HM3; EGBRS
• Gene ID: 1131
• mRNA Refseq: NM_000740
• Protein Refseq: NP_000731
• MIM: 118494
• UniProt ID: P20309