Recombinant Human CHRM3 protein, His-tagged

• Cat.No.: CHRM3-7443H
• Product Overview: Recombinant Human CHRM3 protein(P20309)(253-492aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 253-492aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.7 kDa
• AASequence: RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CHRM3 cholinergic receptor, muscarinic 3 [ Homo sapiens ]
• Official Symbol: CHRM3
• Synonyms: CHRM3; cholinergic receptor, muscarinic 3; muscarinic acetylcholine receptor M3; acetylcholine receptor; muscarinic 3; m3 muscarinic receptor; acetylcholine receptor, muscarinic 3; HM3; EGBRS
• Gene ID: 1131
• mRNA Refseq: NM_000740
• Protein Refseq: NP_000731
• MIM: 118494
• UniProt ID: P20309